Recombinant Human Protein phosphatase 1 regulatory subunit 3G(PPP1R3G)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Protein Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin Level
Biological Activity
Uniprot ID B7ZBB8
Gene Names PPP1R3G
Alternative Names
Expression Region 1-358aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1477 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1599℃.
Protein Length Full Length
Molecular Weight 45.5 kDa
Protein Sequence MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLSPKEEAAPQEQEELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLGPGGCCAKCKKRVQFADTLGLSLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGLLAAAAVAAPLSAPPSRLRPLFQLPGPSAAAERLQRQRVCLERVQCSTASGAEVKGSGRVLSCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAPSGASEPGSGDAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRYARPADAL
Background
Research Areas Others
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$298.00
In stock
SKU
EB-N232520

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Protein phosphatase 1 regulatory subunit 3G(PPP1R3G)
Copyright © 2021-present Echo Biosystems. All rights reserved.