Recombinant Human Protein phosphatase 1 regulatory subunit 1B(PPP1R1B)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9UD71
Gene Names PPP1R1B
Alternative Names DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein
Expression Region Full Length of Isoform 2(1-168aa )
Molecular Weight 45.7 kDa
Protein Sequence MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Inhibitor of protein-phosphatase 1.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families Protein phosphatase inhibitor 1 family
Tissue Specificity PPP1R1B
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE0HU880195

Recombinant Human Protein phosphatase 1 regulatory subunit 1B(PPP1R1B)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Protein phosphatase 1 regulatory subunit 1B(PPP1R1B)
Copyright © 2021-present Echo Biosystems. All rights reserved.