Recombinant Human Protein disulfide-isomerase TMX3(TMX3)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q96JJ7
Gene Names TMX3
Alternative Names Thioredoxin domain-containing protein 10Thioredoxin-related transmembrane protein 3
Expression Region Full Length of Isoform 2(25-195aa )
Molecular Weight 35.6 kDa
Protein Sequence KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase.
Involvement in Disease
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families Protein disulfide isomerase family
Tissue Specificity TMX3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE5HU846770

Recombinant Human Protein disulfide-isomerase TMX3(TMX3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Protein disulfide-isomerase TMX3(TMX3)
Copyright © 2021-present Echo Biosystems. All rights reserved.