Recombinant Human Protein delta homolog 1(DLK1) ,partial

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal Flag-Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P80370
Gene Names DLK1
Alternative Names pG2
Expression Region Partial(24-303aa )
Molecular Weight 32.8 kDa
Protein Sequence AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May have a role in neuroendocrine differentiation.
Involvement in Disease
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families
Tissue Specificity DLK1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$396.00
In stock
SKU
EB-PM5HU7070

Recombinant Human Protein delta homolog 1(DLK1) ,partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Protein delta homolog 1(DLK1) ,partial
Copyright © 2021-present Echo Biosystems. All rights reserved.