Specification
| Description | Recombinant protein from Homo sapiens prominin 2 (PROM2), transcript variant 3 (NM_144707). |
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli/Yeast/Mammalian/Baculovirus |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8N271 |
| Entry Name | PROM2_HUMAN |
| Gene Names | PROM2 PROML2 UNQ2521/PRO6014 |
| Alternative Gene Names | PROML2 |
| Alternative Protein Names | Prominin-2 (PROM-2) (Prominin-like protein 2) (hPROML2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Please contact us for the informtion |
| Form | Lyophilized or Liquid |
| Length | 80 |
| Molecular Weight(Da) | 8871 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) ATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRFLSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGY |
Background
| Function | |
| Pathway | |
| Protein Families | Prominin family |
| Tissue Specificity | Present in saliva within small membrane particles (at protein level). Expressed in kidney, prostate, trachea, esophagus, salivary gland, thyroid gland, mammary gland adrenal gland, placenta, stomach, spinal cord and liver. In submucosal tumor, expressed in spindle-shaped or stellate stromal cells. Expressed in prostate cancer cell lines. {ECO:0000269|PubMed:12446606, ECO:0000269|PubMed:12514187, ECO:0000269|PubMed:16673119, ECO:0000269|PubMed:17874118}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
