Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9BUL8 |
| Gene Names | PDCD10 |
| Alternative Names | Cerebral cavernous malformations 3 protein;TF-1 cell apoptosis-related protein 15 |
| Expression Region | Full Length(1-212aa ) |
| Molecular Weight | 40.7 kDa |
| Protein Sequence | MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity. Important for cell migration, and for normal structure and assbly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hatopoiesis during bryonic development . |
| Involvement in Disease | Cerebral cavernous malformations 3 (CCM3) |
| Subcellular Location | Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side |
| Protein Families | PDCD10 family |
| Tissue Specificity | PDCD10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
