Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O14511
Gene Names NRG2
Alternative Names Divergent of neuregulin-1 Short name: DON-1 Neural- and thymus-derived activator for ERBB kinases Short name: NTAK
Expression Region Extracellular Domain(112-405aa )
Molecular Weight 34.8 kDa
Protein Sequence CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Involvement in Disease
Subcellular Location Pro-neuregulin-2, membrane-bound isoform: Cell membrane, Single-pass type I membrane protein
Protein Families Neuregulin family
Tissue Specificity NRG2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$225.00
In stock
SKU
EB-PY8HU16203

Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.