Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q99471 |
| Gene Names | PFDN5 |
| Alternative Names | C-Myc-binding protein Mm-1Myc modulator 1 |
| Expression Region | Full Length of Mature Protein(2-154aa ) |
| Molecular Weight | 44.2 kDa |
| Protein Sequence | AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC. |
| Involvement in Disease | |
| Subcellular Location | Isoform 1: Nucleus, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Nucleus |
| Protein Families | Prefoldin subunit alpha family |
| Tissue Specificity | PFDN5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
