Recombinant Human PRADC1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens protease associated domain containing 1 (PRADC1), transcript variant 1 (NM_032319).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BSG0
Entry Name PADC1_HUMAN
Gene Names PRADC1 C2orf7 PAP21 UNQ833/PRO1760
Alternative Gene Names C2orf7 PAP21
Alternative Protein Names Protease-associated domain-containing protein 1 (Protease-associated domain-containing protein of 21 kDa) (hPAP21)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 188
Molecular Weight(Da) 21042
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW
Background
Function FUNCTION: Plays a role in the modulation of physical activity and adiposity. {ECO:0000250|UniProtKB:Q9D9N8}.
Pathway
Protein Families
Tissue Specificity Highly expressed in skeletal muscle, heart and liver. Expressed at intermediate level in kidney. {ECO:0000269|PubMed:15498570}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8493735

Recombinant Human PRADC1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PRADC1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.