Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens PRAC1 small nuclear protein (PRAC1) (NM_032391). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96KF2 |
| Entry Name | PRAC1_HUMAN |
| Gene Names | PRAC1 C17orf92 PRAC |
| Alternative Gene Names | C17orf92 PRAC |
| Alternative Protein Names | Small nuclear protein PRAC1 (Prostate cancer susceptibility candidate protein 1) (Prostate, rectum and colon expressed gene protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 57 |
| Molecular Weight(Da) | 5959 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP |
Background
| Function | |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Highly expressed in prostate, rectum, and distal colon, and weakly expressed in bladder. Expressed in prostate cancer cell lines. {ECO:0000269|PubMed:11340635}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |