Recombinant Human PPY protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens pancreatic polypeptide (PPY), transcript variant 1 (NM_002722).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P01298
Entry Name PAHO_HUMAN
Gene Names PPY PNP
Alternative Gene Names PNP
Alternative Protein Names Pancreatic prohormone (Pancreatic polypeptide) (PP) (Obinepitide) [Cleaved into: Pancreatic hormone (PH); Pancreatic icosapeptide (PI)]
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 95
Molecular Weight(Da) 10445
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
Background
Function FUNCTION: Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.; FUNCTION: The physiological role for the icosapeptide has not yet been elucidated.
Pathway
Protein Families NPY family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8054185

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PPY protein
Copyright © 2021-present Echo Biosystems. All rights reserved.