Recombinant Human PPTC7 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens protein phosphatase targeting COQ7 (PPTC7), transcript variant 1 (NM_139283).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8NI37
Entry Name PPTC7_HUMAN
Gene Names PPTC7 TAPP2C
Alternative Gene Names TAPP2C
Alternative Protein Names Protein phosphatase PTC7 homolog (EC 3.1.3.16) (T-cell activation protein phosphatase 2C) (TA-PP2C) (T-cell activation protein phosphatase 2C-like)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 304
Molecular Weight(Da) 32646
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MFSVLSYGRLVARAVLGGLSQTDPRAGGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEYTD
Background
Function FUNCTION: Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q (PubMed:30267671). Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation (PubMed:30267671). {ECO:0000269|PubMed:30267671}.
Pathway
Protein Families PP2C family
Tissue Specificity Expressed in keratinocytes (at protein level). {ECO:0000269|PubMed:29043977}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8427985

Recombinant Human PPTC7 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PPTC7 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.