Recombinant Human PPP1R7 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens protein phosphatase 1 regulatory subunit 7 (PPP1R7), transcript variant 1 (NM_002712).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q15435
Entry Name PP1R7_HUMAN
Gene Names PPP1R7 SDS22
Alternative Gene Names SDS22
Alternative Protein Names Protein phosphatase 1 regulatory subunit 7 (Protein phosphatase 1 regulatory subunit 22)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 360
Molecular Weight(Da) 41564
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Background
Function FUNCTION: Regulatory subunit of protein phosphatase 1. {ECO:0000250}.
Pathway
Protein Families SDS22 family
Tissue Specificity Widely expressed. {ECO:0000269|PubMed:7498485}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8431165

Recombinant Human PPP1R7 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PPP1R7 protein
Copyright © 2026-present Echo Bio. All rights reserved.