Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens protein phosphatase 1 regulatory inhibitor subunit 1C (PPP1R1C), transcript variant 3 (NM_001080545). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8WVI7 |
| Entry Name | PPR1C_HUMAN |
| Gene Names | PPP1R1C |
| Alternative Gene Names | |
| Alternative Protein Names | Protein phosphatase 1 regulatory subunit 1C (Inhibitor-5 of protein phosphatase 1) (IPP5) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 109 |
| Molecular Weight(Da) | 12346 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH |
Background
| Function | FUNCTION: May increase cell susceptibility to TNF-induced apoptosis. {ECO:0000269|PubMed:19874272}. |
| Pathway | |
| Protein Families | Protein phosphatase inhibitor 1 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |