Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O95069 |
| Gene Names | KCNK2 |
| Alternative Names | Outward rectifying potassium channel protein TREK-1 TREK-1 K(+) channel subunit Two pore domain potassium channel TREK-1 Two pore potassium channel TPKC1 |
| Expression Region | Partial(1-143aa ) |
| Molecular Weight | 17.7 kDa |
| Protein Sequence | MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Ion channel that contributes to passive transmembrane potassium transport (PubMed:23169818). Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner (PubMed:11319556). In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2. In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 |
| Involvement in Disease | |
| Subcellular Location | Isoform 1: Cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform 4: Endoplasmic reticulum membrane, Multi-pass membrane protein |
| Protein Families | Two pore domain potassium channel (TC 1.A.1.8) family |
| Tissue Specificity | KCNK2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |