Recombinant Human Poly(A)-specific ribonuclease PARN(PARN)

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O95453
Gene Names PARN
Alternative Names Deadenylating nucleaseDeadenylation nucleasePolyadenylate-specific ribonuclease
Expression Region Full Length(1-639aa )
Molecular Weight 75.5 kDa
Protein Sequence MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance 3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early bryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain prature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elents (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the roval of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization.
Involvement in Disease Dyskeratosis congenita, autosomal recessive, 6 (DKCB6); Pulmonary fibrosis, and/or bone marrow failure, telomere-related, 4 (PFBMFT4)
Subcellular Location Nucleus, Cytoplasm, Nucleus, nucleolus
Protein Families CAF1 family
Tissue Specificity PARN
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$225.00
In stock
SKU
EB-PY6HU17581

Recombinant Human Poly(A)-specific ribonuclease PARN(PARN)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Poly(A)-specific ribonuclease PARN(PARN)
Copyright © 2021-present Echo Biosystems. All rights reserved.