Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens RNA polymerase II subunit K (POLR2K) (NM_005034). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P53803 |
| Entry Name | RPAB4_HUMAN |
| Gene Names | POLR2K |
| Alternative Gene Names | |
| Alternative Protein Names | DNA-directed RNA polymerases I, II, and III subunit RPABC4 (RNA polymerases I, II, and III subunit ABC4) (ABC10-alpha) (DNA-directed RNA polymerase II subunit K) (RNA polymerase II 7.0 kDa subunit) (RPB7.0) (RPB10alpha) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 58 |
| Molecular Weight(Da) | 7004 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR |
Background
| Function | FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. |
| Pathway | |
| Protein Families | Archaeal Rpo12/eukaryotic RPC10 RNA polymerase subunit family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |