Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens NPHS2 stomatin family member, podocin (NPHS2), transcript variant 1 (NM_014625). |
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli/Yeast |
| Tag Info | N-terminal 10xHis-tagged, Or Specified by Customer. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 85% by SDS-PAGE gel |
| Uniprot ID | Q9NP85 |
| Entry Name | PODO_HUMAN |
| Gene Names | NPHS2 |
| Alternative Gene Names | |
| Alternative Protein Names | Podocin |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Please contact us for the information |
| Form | Lyophilized or Liquid |
| Length | TBD |
| Molecular Weight(Da) | TBD |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) CVKVVQEYERVIIFRLGHLLPGRAKGPGLFFLPCLDTYHKVDLRLQTLEIPFHEIVTKD |
QC Data
| Please contact us for specific QC data. |