Recombinant Human PNPLA5 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens patatin like phospholipase domain containing 5 (PNPLA5), transcript variant 1 (NM_138814).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q7Z6Z6
Entry Name PLPL5_HUMAN
Gene Names PNPLA5 GS2L
Alternative Gene Names GS2L
Alternative Protein Names Patatin-like phospholipase domain-containing protein 5 (EC 3.1.1.3) (GS2-like protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 429
Molecular Weight(Da) 47912
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGFLEEEGRWNLSFSGAGYLGAHHVGATECLRQRAPRLLQGARRIYGSSSGALNAVSIVCGKSVDFCCSHLLGMVGQLERLSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFLVTDFATCDELIQALVCTLYFPFYCGLIPPEFRGERYIDGALSNNLPFADCPSTITVSPFHGTVDICPQSTSPNLHELNVFNFSFQISTENFFLGLICLIPPSLEVVADNCRQGYLDALRFLERRGLTKEPVLWTLVSKEPPAPADGNWDAGCDQRWKGGLSLNWKVPHVQVKDVPNFEQLSPELEAALKKACTRDPSRWARFWHSGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQGLLRNMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA
Background
Function FUNCTION: Has abundant triacylglycerol lipase activity. {ECO:0000269|PubMed:16150821}.
Pathway
Protein Families
Tissue Specificity Expressed in brain and pituitary gland. {ECO:0000269|PubMed:16799181}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8450906

Recombinant Human PNPLA5 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PNPLA5 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.