Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) (NM_021127). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q13794 |
| Entry Name | APR_HUMAN |
| Gene Names | PMAIP1 NOXA |
| Alternative Gene Names | NOXA |
| Alternative Protein Names | Phorbol-12-myristate-13-acetate-induced protein 1 (PMA-induced protein 1) (Immediate-early-response protein APR) (Protein Noxa) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 54 |
| Molecular Weight(Da) | 6030 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT |
Background
| Function | FUNCTION: Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1 (By similarity). Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1. {ECO:0000250, ECO:0000269|PubMed:10807576, ECO:0000269|PubMed:15694340, ECO:0000269|PubMed:15705586, ECO:0000269|PubMed:17374615, ECO:0000269|PubMed:17389404}. |
| Pathway | |
| Protein Families | PMAIP1 family |
| Tissue Specificity | Highly expressed in adult T-cell leukemia cell line. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |