Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9UIW2 |
| Gene Names | PLXNA1 |
| Alternative Names | Semaphorin receptor NOV |
| Expression Region | Partial(32-296aa ) |
| Molecular Weight | 33.3 kDa |
| Protein Sequence | RAGGGSQPPFRTFSASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Coreceptor for SA3A, SA3C, SA3F and SA6D. Necessary for signaling by class 3 saphorins and subsequent rodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 saphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific saphorins, and its Cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm . |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | Plexin family |
| Tissue Specificity | PLXNA1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |