Specification
Gene Names | GP1BB |
Alternative Names | (GP-Ib beta)(GPIb-beta)(GPIbB)(Antigen CD42b-beta)(CD antigen CD42c) |
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Molecular Weight | 17.9 kDa |
Expression Region | Partial(27-147aa ) |
Expression Region | N-terminal 10xHis-tagged and C-terminal Myc-tagged(Partial ) |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Not test. |
Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
Protein Sequence | PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC |
Background
Research Areas | Others |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |