Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens placenta associated 8 (PLAC8), transcript variant 2 (NM_016619). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NZF1 |
| Entry Name | PLAC8_HUMAN |
| Gene Names | PLAC8 BM-004 |
| Alternative Gene Names | |
| Alternative Protein Names | Placenta-specific gene 8 protein (Protein C15) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 115 |
| Molecular Weight(Da) | 12507 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF |
Background
| Function | |
| Pathway | |
| Protein Families | Cornifelin family |
| Tissue Specificity | Expressed at high levels in plasmacytoid dendritic cells. High expression in spleen, lymph nodes, peripheral blood leukocytes, and bone marrow, with lower expression in thymus, appendix, and fetal liver. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
