Recombinant Human PLAC1 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens placenta specific 1 (PLAC1), transcript variant 1 (NM_021796).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9HBJ0
Entry Name PLAC1_HUMAN
Gene Names PLAC1
Alternative Gene Names
Alternative Protein Names Placenta-specific protein 1
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 212
Molecular Weight(Da) 23616
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM
Background
Function FUNCTION: May play a role in placental development. {ECO:0000269|PubMed:10995572}.
Pathway
Protein Families PLAC1 family
Tissue Specificity Expressed in placenta. Localizes primarily to differentiated syncytiotrophoblast throughout gestation as well as to a small population of villous cytotrophoblasts. Also detected in maternal blood and rapidly disappears following delivery, but is not detected in other adult or fetal tissues examined. {ECO:0000269|PubMed:10995572, ECO:0000269|PubMed:12412044, ECO:0000269|PubMed:15608456, ECO:0000269|PubMed:15803460}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8411995

Recombinant Human PLAC1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PLAC1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.