Recombinant Human PLA2G2F protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens phospholipase A2 group IIF (PLA2G2F), transcript variant 1 (NM_022819).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BZM2
Entry Name PA2GF_HUMAN
Gene Names PLA2G2F
Alternative Gene Names
Alternative Protein Names Group IIF secretory phospholipase A2 (GIIF sPLA2) (sPLA2-IIF) (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase 2F)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 168
Molecular Weight(Da) 18658
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MKKFFTVAILAGSVLSTAHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVYCQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP
Background
Function FUNCTION: Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at the sn-2 position of phospholipids (phospholipase A2 activity), the catalytic efficiency decreasing in the following order: phosphatidylglycerols > phosphatidylethanolamines > phosphatidylcholines > phosphatidylserines (PubMed:11112443). May play a role in lipid mediator production in inflammatory conditions, by providing arachidonic acid to downstream cyclooxygenases and lipoxygenases (By similarity). {ECO:0000250|UniProtKB:Q9QZT4, ECO:0000269|PubMed:11112443}.
Pathway
Protein Families Phospholipase A2 family
Tissue Specificity Expressed at high levels in placenta, testis, thymus and at lower levels in heart, kidney, liver and prostate (PubMed:11112443). Highly expressed in rheumatoid arthritic tissues, including synovial lining cells in the intima, capillary endothelial cells and plasma cells (PubMed:11877435). {ECO:0000269|PubMed:11112443, ECO:0000269|PubMed:11877435}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8569835

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PLA2G2F protein
Copyright © 2021-present Echo Biosystems. All rights reserved.