Recombinant Human PLA2G12B protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens phospholipase A2 group XIIB (PLA2G12B), transcript variant 1 (NM_032562).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BX93
Entry Name PG12B_HUMAN
Gene Names PLA2G12B PLA2G13 FKSG71
Alternative Gene Names PLA2G13
Alternative Protein Names Group XIIB secretory phospholipase A2-like protein (Group XIII secretory phospholipase A2-like protein) (GXIII sPLA2-like) (sPLA2-GXIIB) (GXIIB)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 195
Molecular Weight(Da) 21659
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL
Background
Function FUNCTION: Not known; does not seem to have catalytic activity.
Pathway
Protein Families Phospholipase A2 family
Tissue Specificity Strong expression in liver, small intestine and kidney. {ECO:0000269|PubMed:14516201}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8228925

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PLA2G12B protein
Copyright © 2021-present Echo Biosystems. All rights reserved.