Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens cAMP-dependent protein kinase inhibitor beta (PKIB), transcript variant 3 (NM_032471). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9C010 |
| Entry Name | IPKB_HUMAN |
| Gene Names | PKIB PRKACN2 |
| Alternative Gene Names | PRKACN2 |
| Alternative Protein Names | cAMP-dependent protein kinase inhibitor beta (PKI-beta) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 78 |
| Molecular Weight(Da) | 8468 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK |
Background
| Function | FUNCTION: Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains. {ECO:0000250}. |
| Pathway | |
| Protein Families | PKI family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |