Recombinant Human PIP protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens prolactin induced protein (PIP) (NM_002652).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P12273
Entry Name PIP_HUMAN
Gene Names PIP GCDFP15 GPIP4
Alternative Gene Names GCDFP15 GPIP4
Alternative Protein Names Prolactin-inducible protein (Gross cystic disease fluid protein 15) (GCDFP-15) (Prolactin-induced protein) (Secretory actin-binding protein) (SABP) (gp17)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 146
Molecular Weight(Da) 16572
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Background
Function
Pathway
Protein Families PIP family
Tissue Specificity Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8135385

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PIP protein
Copyright © 2026-present Echo Bio. All rights reserved.