Recombinant Human PI15 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens peptidase inhibitor 15 (PI15), transcript variant 1 (NM_015886).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O43692
Entry Name PI15_HUMAN
Gene Names PI15 CRISP8 P25TI
Alternative Gene Names CRISP8 P25TI
Alternative Protein Names Peptidase inhibitor 15 (PI-15) (25 kDa trypsin inhibitor) (p25TI) (Cysteine-rich secretory protein 8) (CRISP-8) (SugarCrisp)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 258
Molecular Weight(Da) 29065
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLYWFK
Background
Function FUNCTION: Serine protease inhibitor which displays weak inhibitory activity against trypsin (PubMed:8882727). May play a role in facial patterning during embryonic development (By similarity). {ECO:0000250|UniProtKB:Q98ST6, ECO:0000269|PubMed:8882727}.
Pathway
Protein Families CRISP family
Tissue Specificity Weakly expressed. Expressed at low level in prostate, mammary gland, salivary gland and thyroid gland. {ECO:0000269|PubMed:11287197, ECO:0000269|PubMed:9473672}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8316785

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PI15 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.