Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal(PHYH)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O14832
Gene Names PHYH
Alternative Names Phytanic acid oxidase Phytanoyl-CoA alpha-hydroxylase
Expression Region Full Length(1-338aa )
Molecular Weight 62.4 kDa
Protein Sequence SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.
Involvement in Disease Refsum disease (RD)
Subcellular Location Peroxisome
Protein Families PhyH family
Tissue Specificity PHYH
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE6HU18071

Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal(PHYH)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal(PHYH)
Copyright © 2021-present Echo Biosystems. All rights reserved.