Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens phosphohistidine phosphatase 1 (PHPT1), transcript variant 3 (NM_014172). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NRX4 |
| Entry Name | PHP14_HUMAN |
| Gene Names | PHPT1 PHP14 CGI-202 HSPC141 |
| Alternative Gene Names | PHP14 |
| Alternative Protein Names | 14 kDa phosphohistidine phosphatase (EC 3.9.1.3) (Phosphohistidine phosphatase 1) (PHPT1) (Protein histidine phosphatase) (PHP) (Protein janus-A homolog) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 125 |
| Molecular Weight(Da) | 13833 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
Background
| Function | FUNCTION: Exhibits phosphohistidine phosphatase activity. {ECO:0000269|PubMed:19836471, ECO:0000269|PubMed:25574816}. |
| Pathway | |
| Protein Families | Janus family |
| Tissue Specificity | Expressed abundantly in heart and skeletal muscle. {ECO:0000269|PubMed:12383260}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |