Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P48651 |
| Gene Names | PTDSS1 |
| Alternative Names | Serine-exchange enzyme I |
| Expression Region | Partial(1-35aa ) |
| Molecular Weight | 31.1 kDa |
| Protein Sequence | MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine. |
| Involvement in Disease | Lenz-Majewski hyperostotic dwarfism (LMHD) |
| Subcellular Location | Endoplasmic reticulum membrane, Multi-pass membrane protein |
| Protein Families | Phosphatidyl serine synthase family |
| Tissue Specificity | PTDSS1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |