Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8TBF5 |
| Gene Names | PIGX |
| Alternative Names | GPI mannosyltransferase subunit; Phosphatidylinositol glycan class X; Phosphatidylinositol-glycan biosynthesis class X protein; PIG-X; Pigx; PIGX_HUMAN |
| Expression Region | Partial(42-230aa ) |
| Molecular Weight | 37.8 kDa |
| Protein Sequence | MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM . |
| Involvement in Disease | |
| Subcellular Location | Endoplasmic reticulum membrane, Single-pass type I membrane protein |
| Protein Families | PIGX family |
| Tissue Specificity | PIGX |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |