Recombinant Human PET100 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens PET100 homolog (PET100), transcript variant 1 (NM_001171155).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P0DJ07
Entry Name PT100_HUMAN
Gene Names PET100 C19orf79
Alternative Gene Names C19orf79
Alternative Protein Names Protein PET100 homolog, mitochondrial
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 73
Molecular Weight(Da) 9114
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKRREEKLLRDAQQNS
Background
Function FUNCTION: Plays an essential role in mitochondrial complex IV maturation and assembly. {ECO:0000269|PubMed:24462369, ECO:0000269|PubMed:25293719}.
Pathway
Protein Families PET100 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8128456

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PET100 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.