Recombinant Human Peroxisomal carnitine O-octanoyltransferase(CROT)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9UKG9
Gene Names CROT
Alternative Names Carnitine O octanoyltransferase; COT; CROT; OCTC_HUMAN; Peroxisomal carnitine acyltransferase; Peroxisomal carnitine O octanoyltransferase; Peroxisomal carnitine O-octanoyltransferase
Expression Region Full Length of Isoform 2(1-87aa )
Molecular Weight 37.2 kDa
Protein Sequence MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
Involvement in Disease
Subcellular Location Peroxisome
Protein Families Carnitine/choline acetyltransferase family
Tissue Specificity CROT
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE3HU891848

Recombinant Human Peroxisomal carnitine O-octanoyltransferase(CROT)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Peroxisomal carnitine O-octanoyltransferase(CROT)
Copyright © 2021-present Echo Biosystems. All rights reserved.