Recombinant Human Peroxiredoxin-2(PRDX2)

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P32119
Gene Names PRDX2
Alternative Names Natural killer cell-enhancing factor B
Expression Region Full Length of Mature Protein(2-198aa )
Molecular Weight 23.8 kDa
Protein Sequence ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families Peroxiredoxin family, AhpC/Prx1 subfamily
Tissue Specificity PRDX2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$225.00
In stock
SKU
EB-PY5HU339360

Recombinant Human Peroxiredoxin-2(PRDX2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Peroxiredoxin-2(PRDX2)
Copyright © 2021-present Echo Biosystems. All rights reserved.