Specification
    
        | Organism | Homo sapiens (Human) | 
| Expression Host | E.coli | 
| Tag Info | N-terminal GST-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | Q06830 | 
| Gene Names | PRDX1 | 
| Alternative Names | Natural killer cell-enhancing factor A ;NKEF-AProliferation-associated gene protein ;PAGThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2 | 
| Expression Region | Full Length(1-199aa ) | 
| Molecular Weight | 49.1 kDa | 
| Protein Sequence | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin syst but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation . | 
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Melanosome | 
| Protein Families | Peroxiredoxin family, AhpC/Prx1 subfamily | 
| Tissue Specificity | PRDX1 | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) | ![]()  |  
