Recombinant Human Peroxiredoxin-1(PRDX1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q06830
Gene Names PRDX1
Alternative Names Natural killer cell-enhancing factor A ;NKEF-AProliferation-associated gene protein ;PAGThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2
Expression Region Full Length(1-199aa )
Molecular Weight 49.1 kDa
Protein Sequence MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin syst but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation .
Involvement in Disease
Subcellular Location Cytoplasm, Melanosome
Protein Families Peroxiredoxin family, AhpC/Prx1 subfamily
Tissue Specificity PRDX1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PEUe0186655

Recombinant Human Peroxiredoxin-1(PRDX1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Peroxiredoxin-1(PRDX1)
Copyright © 2021-present Echo Biosystems. All rights reserved.