Recombinant Human Peptidyl-tRNA hydrolase ICT1, mitochondrial(ICT1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q14197
Gene Names ICT1
Alternative Names 39S ribosomal protein L58, mitochondrial ;MRP-L58Digestion substraction 1 ;DS-1Immature colon carcinoma transcript 1 protein
Expression Region Full Length of Mature Protein(30-206aa )
Molecular Weight 36.4 kDa
Protein Sequence LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been praturely terminated and thus in the recycling of stalled mitochondrial ribosomes.
Involvement in Disease
Subcellular Location Mitochondrion
Protein Families Prokaryotic/mitochondrial release factor family, Mitochondrion-specific ribosomal protein mL62 subfamily
Tissue Specificity ICT1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE0HU613615

Recombinant Human Peptidyl-tRNA hydrolase ICT1, mitochondrial(ICT1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Peptidyl-tRNA hydrolase ICT1, mitochondrial(ICT1)
Copyright © 2021-present Echo Biosystems. All rights reserved.