Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q14197 |
| Gene Names | ICT1 |
| Alternative Names | 39S ribosomal protein L58, mitochondrial ;MRP-L58Digestion substraction 1 ;DS-1Immature colon carcinoma transcript 1 protein |
| Expression Region | Full Length of Mature Protein(30-206aa ) |
| Molecular Weight | 36.4 kDa |
| Protein Sequence | LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been praturely terminated and thus in the recycling of stalled mitochondrial ribosomes. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion |
| Protein Families | Prokaryotic/mitochondrial release factor family, Mitochondrion-specific ribosomal protein mL62 subfamily |
| Tissue Specificity | ICT1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
