Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3(FKBP3)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q00688
Gene Names FKBP3
Alternative Names 25KDA FK506-binding protein ;25KDA FKBP ;FKBP-25FK506-binding protein 3 ;FKBP-3Immunophilin FKBP25Rapamycin-selective 25KDA immunophilinRotamase
Expression Region Full Length of Mature Protein(2-224aa )
Molecular Weight 41 kDa
Protein Sequence AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct Cytoplasmic domain signal transmission pathways. PPIases accelerate the folding of proteins.
Involvement in Disease
Subcellular Location Nucleus
Protein Families FKBP-type PPIase family
Tissue Specificity FKBP3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE9HU8824

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3(FKBP3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3(FKBP3)
Copyright © 2021-present Echo Biosystems. All rights reserved.