Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P62942 |
| Gene Names | FKBP1A |
| Alternative Names | 12KDA FK506-binding protein ;12KDA FKBP ;FKBP-12;Calstabin-1FK506-binding protein 1A ;FKBP-1AImmunophilin FKBP12Rotamase |
| Expression Region | Partial(2-103aa ) |
| Molecular Weight | 38.2 kDa |
| Protein Sequence | GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruites SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, cytosol, Sarcoplasmic reticulum membrane, Peripheral membrane protein, Cytoplasmic side |
| Protein Families | FKBP-type PPIase family, FKBP1 subfamily |
| Tissue Specificity | FKBP1A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |