Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP14(FKBP14)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9NWM8
Gene Names FKBP14
Alternative Names 22KDA FK506-binding protein ;22KDA FKBP ;FKBP-22FK506-binding protein 14 ;FKBP-14Rotamase
Expression Region Full Length of Mature Protein(20-211aa )
Molecular Weight 38 kDa
Protein Sequence ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance PPIases accelerate the folding of proteins during protein synthesis.
Involvement in Disease Ehlers-Danlos syndrome, with progressive kyphoscoliosis, myopathy, and hearing loss (EDSKMH)
Subcellular Location Endoplasmic reticulum lumen
Protein Families
Tissue Specificity FKBP14
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE9HU865284

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP14(FKBP14)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP14(FKBP14)
Copyright © 2021-present Echo Biosystems. All rights reserved.