Recombinant Human Peptidyl-prolyl cis-trans isomerase A(PPIA)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID P62937
Gene Names PPIA
Alternative Names Cyclophilin ACyclosporin A-binding proteinRotamase A
Expression Region Full Length of Mature Protein(2-165aa )
Molecular Weight 17.9 kDa
Protein Sequence VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Involvement in Disease
Subcellular Location Cytoplasm, Secreted
Protein Families Cyclophilin-type PPIase family, PPIase A subfamily
Tissue Specificity PPIA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$351.00
In stock
SKU
EB-PE1e135181136

Recombinant Human Peptidyl-prolyl cis-trans isomerase A(PPIA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Peptidyl-prolyl cis-trans isomerase A(PPIA)
Copyright © 2021-present Echo Biosystems. All rights reserved.