Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens PDZK1 interacting protein 1 (PDZK1IP1) (NM_005764). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q13113 |
| Entry Name | PDZ1I_HUMAN |
| Gene Names | PDZK1IP1 MAP17 |
| Alternative Gene Names | MAP17 |
| Alternative Protein Names | PDZK1-interacting protein 1 (17 kDa membrane-associated protein) (Protein DD96) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 114 |
| Molecular Weight(Da) | 12227 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM |
Background
| Function | FUNCTION: May play an important role in tumor biology. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed at significant levels only in a single epithelial cell population, the proximal tubular epithelial cells of the kidney. Diffusely expressed in various carcinomas originating from kidney, colon, lung and breast. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |