Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens PDZ domain containing 11 (PDZD11), transcript variant 1 (NM_016484). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q5EBL8 |
| Entry Name | PDZ11_HUMAN |
| Gene Names | PDZD11 AIPP1 PDZK11 PISP HSPC227 UNQ6486/PRO21335 |
| Alternative Gene Names | AIPP1 PDZK11 PISP |
| Alternative Protein Names | PDZ domain-containing protein 11 (ATPase-interacting PDZ protein) (Plasma membrane calcium ATPase-interacting single-PDZ protein) (PMCA-interacting single-PDZ protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 140 |
| Molecular Weight(Da) | 16131 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH |
Background
| Function | FUNCTION: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10-binding protein TSPAN33. {ECO:0000269|PubMed:30463011}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Widely expressed (at protein level). {ECO:0000269|PubMed:12763866}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |