Recombinant Human PDCL3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens phosducin like 3 (PDCL3) (NM_024065).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9H2J4
Entry Name PDCL3_HUMAN
Gene Names PDCL3 PhLP2A VIAF1
Alternative Gene Names PhLP2A VIAF1
Alternative Protein Names Phosducin-like protein 3 (HTPHLP) (PhPL3) (Viral IAP-associated factor 1) (VIAF-1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 239
Molecular Weight(Da) 27614
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
Background
Function FUNCTION: Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, increasing its abundance by inhibiting its ubiquitination and degradation (PubMed:23792958, PubMed:26059764). Inhibits the folding activity of the chaperonin-containing T-complex (CCT) which leads to inhibition of cytoskeletal actin folding (PubMed:17429077). Acts as a chaperone during heat shock alongside HSP90 and HSP40/70 chaperone complexes (By similarity). Modulates the activation of caspases during apoptosis (PubMed:15371430). {ECO:0000250|UniProtKB:Q4KLJ8, ECO:0000269|PubMed:15371430, ECO:0000269|PubMed:17429077, ECO:0000269|PubMed:23792958, ECO:0000269|PubMed:26059764}.
Pathway
Protein Families Phosducin family
Tissue Specificity Expressed in endothelial cells (at protein level) (PubMed:26059764). Expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine and colon (PubMed:15371430). {ECO:0000269|PubMed:15371430, ECO:0000269|PubMed:26059764}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8220165

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PDCL3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.