Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens Purkinje cell protein 4 (PCP4) (NM_006198). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P48539 |
| Entry Name | PCP4_HUMAN |
| Gene Names | PCP4 PEP19 |
| Alternative Gene Names | PEP19 |
| Alternative Protein Names | Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 62 |
| Molecular Weight(Da) | 6791 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS |
Background
| Function | FUNCTION: Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls (PubMed:19106096, PubMed:23204517, PubMed:27876793). For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways (PubMed:21491429). {ECO:0000269|PubMed:19106096, ECO:0000269|PubMed:21491429, ECO:0000269|PubMed:23204517, ECO:0000269|PubMed:27876793}. |
| Pathway | |
| Protein Families | PCP4 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |