Recombinant Human Parvalbumin alpha(PVALB)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P20472
Gene Names PVALB
Alternative Names D22S749; MGC116759; Parvalbumin alpha; PRVA_HUMAN; PVALB
Expression Region Full Length of Mature Protein(2-110aa )
Molecular Weight 27.9 kDa
Protein Sequence SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
Involvement in Disease
Subcellular Location
Protein Families Parvalbumin family
Tissue Specificity PVALB
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE2HU19217

Recombinant Human Parvalbumin alpha(PVALB)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Parvalbumin alpha(PVALB)
Copyright © 2021-present Echo Biosystems. All rights reserved.