Specification
| Organism | Human parainfluenza 1 virus (strain C39) (HPIV-1) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P24304 |
| Gene Names | N |
| Alternative Names | Nucleoprotein(Nucleocapsid protein)(NP)(Protein N) |
| Expression Region | Full Length(1-524aa ) |
| Molecular Weight | 63.6 kDa |
| Protein Sequence | MAGLLSTFDTFSSRRSESINKSGGGAIIPGQRSTVSVFILGPSVTDDADKLLIATTFLAHSLDTDKQHSQRGGFLVSLLAMAYSSPELYLTTNGVNADVKYVIYNIERDPKRTKTDGFIVKTRDMEYERTTEWLFGPMINKNPLFQGQRENADLEALLQTYGYPACLGAIIVQVWIVLVKAITSSSGLRKGFFNRLEAFRQDGTVKSALVFTGDTVEGIGAVMRSQQSLVSLMVETLVTMNTSRSDLTTLEKNIQIVGNYIRESGLASFMNTIKYGVETKMAALTLSNLRPDINKLRSLVDIYLSKGARAPFTCILRDPVHGEFAPGNYPALWSYAMGVAVVQNKAMQQYVTGRTYLDMEMFLLGQAVAKDADSKISSALEEELGVTDTAKERLRHHLTNLSGGDGAYHKPTGGGAIEVAIDHTDITFGAEDTADRDNKNWTNNSNERWMNHSINNHTITISGAEELEEETNDEDITDIENKIARRLADRKQRLSQANNRQDASSDADHENDDDATAAAGIGGI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases (By similarity). |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | N |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |