Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens presequence translocase associated motor 16 (PAM16) (NM_016069). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y3D7 |
| Entry Name | TIM16_HUMAN |
| Gene Names | PAM16 MAGMAS TIM16 TIMM16 CGI-136 |
| Alternative Gene Names | MAGMAS TIM16 TIMM16 |
| Alternative Protein Names | Mitochondrial import inner membrane translocase subunit TIM16 (Mitochondria-associated granulocyte macrophage CSF-signaling molecule) (Presequence translocated-associated motor subunit PAM16) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 125 |
| Molecular Weight(Da) | 13825 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT |
Background
| Function | FUNCTION: Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity. {ECO:0000269|PubMed:20053669}. |
| Pathway | |
| Protein Families | TIM16/PAM16 family |
| Tissue Specificity | Ubiquitously expressed. {ECO:0000269|PubMed:15704001}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |