Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens PAGE family member 4 (PAGE4), transcript variant 1 (NM_007003). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O60829 |
| Entry Name | PAGE4_HUMAN |
| Gene Names | PAGE4 GAGEC1 JM27 |
| Alternative Gene Names | GAGEC1 |
| Alternative Protein Names | P antigen family member 4 (PAGE-4) (G antigen family C member 1) (PAGE-1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 102 |
| Molecular Weight(Da) | 11153 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP |
Background
| Function | FUNCTION: Intrinsically disordered protein that potentiates the transcriptional activator activity of JUN (PubMed:24263171, PubMed:28289210). Protects cells from stress-induced apoptosis by inhibiting reactive oxygen species (ROS) production and via regulation of the MAPK signaling pathway (PubMed:21357425, PubMed:25374899, PubMed:30658679). {ECO:0000269|PubMed:21357425, ECO:0000269|PubMed:24263171, ECO:0000269|PubMed:25374899, ECO:0000269|PubMed:28289210, ECO:0000269|PubMed:30658679}. |
| Pathway | |
| Protein Families | GAGE family |
| Tissue Specificity | Expressed at basal lvels in the adult normal prostate gland but is highly up-regulated in the fetal prostate and prostate cancer cells (PubMed:12489849, PubMed:25374899, PubMed:24559171, PubMed:24263171). Preferentially expressed in normal male and female reproductive tissues, testis, fallopian tube, uterus, and placenta, as well as in testicular cancer, uterine cancer, cervical cancer and kidney cancer (PubMed:9724777, PubMed:12489849). {ECO:0000269|PubMed:12489849, ECO:0000269|PubMed:24263171, ECO:0000269|PubMed:24559171, ECO:0000269|PubMed:25374899, ECO:0000269|PubMed:9724777}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |